How Much Does Peptide Synthesis Cost Per Amino Acid?
Last Updated: October 25, 2026
Quick Summary
Peptide synthesis cost per amino acid ranges from around $2.00 for crude peptides to $15.50 for high-purity peptides, depending on purity level, synthesis scale, sequence complexity, and vendor pricing. Beyond the base per-residue rate, purity premiums, modification fees, scale surcharges, and minimum order charges significantly affect your total cost.
- Crude peptides cost the least at baseline rates; standard purity adds 20-30%, while high purity (95-98%) can double or triple the base cost.
- Purity level is the single largest cost driver, with the jump from crude to 90% costing less than the jump from 90% to 98%.
- Longer peptides trigger surcharges above 40-50 residues depending on vendor, with 60-residue peptides costing 2.8-3.2 times more than 25-residue ones.
- Modifications like acetylation, phosphorylation, and biotinylation add significant fees that compound when multiple modifications are requested.
- Request detailed quotes from at least three vendors specifying sequence, purity tier, scale, modifications, and turnaround to compare total cost accurately.
Table of Contents
- Peptide Synthesis Cost Per Amino Acid: What Determines Your Quote
- How Peptide Purity and Pricing Affect Your Total Cost
- Peptide Synthesis Cost by Length: Calculating Your Order Total
- Building a Peptide Synthesis Cost Calculator for Your Lab
- Peptide Synthesis Quote Comparison: What to Expect From Vendors
- Cost Breakdown: Sequence Difficulty, Modifications, and Surcharges
- Getting Your First Quote From a Peptide Synthesis Service
- Frequently Asked Questions
Peptide Synthesis Cost Per Amino Acid: What Determines Your Quote
Understanding peptide synthesis cost per amino acid is the first step toward an accurate research budget. Beyond sequence length, purity requirements, synthesis scale, sequence complexity, and delivery timeline all shift the final quote significantly.
Crude peptides start around $2.00 per amino acid residue; high-purity peptides can reach $15.50 per residue depending on scale and specifications. Synthesis difficulty, order specifications, and vendor pricing models compound.
Real quotes include scale surcharges, purity premiums, modification fees, and minimum order charges vendors don’t always advertise upfront. Understanding these layers helps you compare vendors accurately and negotiate better terms.
How Peptide Purity and Pricing Affect Your Total Cost
Purity level is the single largest cost driver in peptide synthesis pricing. Learn how purity specifications and pricing interact to understand the full cost impact of your chosen purity tier. Crude synthesis delivers your sequence at typically 70-80% purity and costs the least.
The pricing tiers typically break down this way: crude peptides sit at the baseline per-amino-acid rate. Standard purity (85-90%) adds roughly 20-30% to the base cost. High purity (95-98%) can double or triple the base cost depending on sequence complexity. Ultra-pure peptides (>98%) push costs even higher at smaller scales.
Purity premiums aren’t linear: the jump from crude to 90% costs less than 90% to 98%, because final purification steps remove increasingly small amounts of impurity with proportionally more effort.
Sequence composition also affects purity costs. Proline-rich sequences or those with multiple post-translational modifications require longer synthesis cycles and more aggressive purification. A straightforward 40-residue sequence might synthesize faster and cleaner than a 35-residue sequence with three modifications, so the shorter peptide could cost more.
For your lab, the practical question is: what purity do you actually need? If your analytical method requires >97% purity and you order crude material, your results will fail. research standards for peptide purity in analytical chemistry provide guidance on minimum purity for different applications, though your specific protocol may have stricter requirements.
Purity level is the primary cost driver, with pricing increasing significantly as purity requirements rise.
| Purity Level | Typical Range | Cost vs Baseline |
|---|---|---|
| Crude | 70-80% | Baseline rate |
| Standard | 85-90% | +20-30% |
| High Purity | 95-98% | 2-3x baseline |
| Ultra-Pure | >98% | Higher at smaller scales |
Peptide Synthesis Cost by Length: Calculating Your Order Total
Longer peptides cost more because they require more amino acid residues and longer synthesis cycles. A 20-residue peptide costs roughly twice what a 10-residue peptide costs, assuming identical purity and scale.
Most vendors cap standard synthesis at 30-50 amino acids without surcharges. Beyond that threshold, many apply long-peptide surcharges. Attempting to synthesize beyond a vendor’s comfortable range triggers exponential cost increases or outright refusals.
A worked example: a 25-residue crude peptide will cost less than the same peptide at 98%+ purity on a 5 mg scale. A 50-residue crude peptide would cost more than a 25-residue one, and a long-peptide surcharge above 40 residues would increase the cost further.
Length and cost aren’t purely multiplicative. Longer peptides have higher synthesis failure rates, requiring more starting material and purification to hit target purity. A 60-residue peptide typically costs 2.8-3.2 times a 25-residue peptide, not 2.4 times, because synthesis is harder.
When requesting a quote, specify your exact peptide length and ask whether surcharges apply above certain thresholds. Some vendors publish their surcharge structure; others reveal it only in quotes. Bulk Peptide Pricing for Labs: 2026 Guide breaks down how volume discounts interact with length-based pricing, which becomes critical if you’re ordering multiple sequences or repeat batches.
Building a Peptide Synthesis Cost Calculator for Your Lab
A simple cost model helps you evaluate quotes quickly and plan budgets across sequences. The formula: (residue count × per-residue rate) + purity premium + scale surcharge + modification fees + minimum order charge = total cost.
Document your vendor’s published rates: crude cost per residue, purity-adjusted rates, and scale thresholds (many vendors show different per-residue rates for 1 mg, 5 mg, 10 mg, and 25 mg scales). Larger scales often reduce per-residue cost as batch efficiency improves.
Factor in modifications: acetylation or amidation, phosphorylation, biotinylation, and fluorescent labeling all add to the cost. Multiple modifications compound the cost.
Apply your vendor’s minimum order charge. Many vendors set a floor per order. This matters most for short peptides or when you’re testing multiple sequences in parallel.
peptide reconstitution and concentration calculations for research use require accurate milligram and micromolar conversions. Peptide Reconstitution Calculator provides a free tool to convert your vial weight and reconstitution volume into usable concentrations, which helps you understand the actual cost per unit dose in your experiments.
A practical spreadsheet tracks peptide name, sequence, length, purity tier, scale, per-residue cost, purity premium, modification fees, minimum order charge, final quote, and date received. Over time it reveals which vendors price your typical order profile best and which have the fastest turnaround.
Peptide Synthesis Quote Comparison: What to Expect From Vendors
Standardize your assumptions: request quotes for the identical sequence, purity level, and scale from at least three vendors. Inconsistent specifications make price comparison meaningless.
Some vendors publish starting prices clearly, which can make budgeting easier, though your actual quote will depend on your specific sequence.
Some vendors list a starting price for crude synthesis. However, the final quote depends heavily on sequence composition and your chosen purity tier. A straightforward sequence might hit that rate; a difficult sequence could cost more.
Other vendors publish crude peptide pricing in various ranges. Some advertise competitive starting prices for peptides up to 150 amino acids, making them competitive for longer sequences where other vendors apply surcharges.
Some larger vendors do not publish per-residue rates; you must request a quote. They often customize pricing by batch size and volume history, which frustrates budget planning but can yield better pricing for large or repeat orders.
Watch for hidden costs: some vendors include HPLC analysis, mass spectrometry verification, and a Certificate of Analysis in the base price; others bill them separately.
best practices for evaluating peptide synthesis vendors emphasize that the lowest price isn’t always the best value.
Turnaround time affects real cost. Standard synthesis takes 2-3 weeks; expedited costs 30-50% more but delivers in 5-7 days. If your timeline is flexible, standard saves money; if you’re racing a grant or publication deadline, the premium may be worth it.
Cost Breakdown: Sequence Difficulty, Modifications, and Surcharges
Beyond length and purity, synthesis difficulty is the hidden cost variable. Proline-rich peptides, sequences with multiple hydrophobic residues, and peptides containing non-standard amino acids all require longer synthesis cycles and more aggressive purification.
Vendors rarely publish a difficulty surcharge explicitly. Instead, it’s baked into their quote. A 40-residue proline-rich peptide might cost 20-30% more than a 40-residue “easy” sequence because synthesis is slower and yields are lower.
Modifications add significant cost: N-terminal acetylation, C-terminal amidation, phosphorylation on serine, threonine, or tyrosine, biotinylation, and fluorescent label conjugation (FITC, rhodamine, etc.) all increase the price depending on chemistry.
If your peptide needs multiple modifications, costs compound. A 35-residue peptide with N-terminal acetylation, C-terminal amidation, and one phosphorylation site will add modification fees on top of the base synthesis cost, resulting in a significant increase on a typical synthesis order.
Minimum order charges protect vendors against low-revenue small orders; most set a minimum. This matters most for short peptides (10-15 residues) or parallel sequence testing. A short peptide might calculate to a low cost, but a minimum order means you pay the minimum.
Some vendors waive minimum charges for high-volume customers or offer volume discounts that offset them. If you’re ordering 10+ peptides at once, negotiate the minimum order charge as part of the total package. Bulk Peptide Order Volume Discounts: A 2026 Guide explains how volume tiers work and when bulk ordering actually saves money versus ordering sequences individually.
Long-peptide surcharges kick in above 40-50 residues depending on the vendor. A 60-residue peptide might carry a 15-25% surcharge. A 100-residue peptide could carry a 40-50% surcharge because synthesis becomes significantly harder and slower. Ask your vendor explicitly: At what length do surcharges apply? How much is the surcharge percentage?
Getting Your First Quote From a Peptide Synthesis Service
Requesting your first quote is straightforward, but complete information upfront saves back-and-forth and ensures accurate pricing.
Start with your peptide sequence in single-letter amino acid code. Example: MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQ. Most vendors accept sequences via their online quote form or email.
Specify target purity: crude (70-80%), standard (85-90%), high purity (95-98%), or ultra-pure (>98%). If unsure, ask your lab’s analytical chemistry lead or PI what your assay requires.
State your desired synthesis scale: 1 mg, 5 mg, 10 mg, or 25 mg. Larger scales reduce per-milligram cost but require more storage space and may exceed your immediate needs.
List any modifications: N-terminal acetylation, C-terminal amidation, phosphorylation sites, biotinylation, fluorescent labels, or non-standard amino acids. Be specific about the position and type of modification.
Specify your turnaround requirement: standard (2-3 weeks), expedited (5-7 days), or rush (3-5 days). Standard turnaround costs the least; expedited and rush synthesis carry premiums.
Ask about delivery: standard shipping is typically ground in 3-5 business days; temperature-controlled shipping costs extra but preserves peptide integrity in transit and is worth it for degradation-sensitive peptides.
Ask about their quality assurance process. FROPeptides uses multi-stage HPLC testing and mass spectrometry verification for every batch, with batch-level Certificates of Analysis documenting purity and identity. quality standards for research-grade peptides define what rigorous testing looks like.
Once quotes from 2-3 vendors arrive, compare total cost, not just per-residue rates, factoring in turnaround time, quality verification methods, and shipping. The lowest price isn’t always the best value; a slightly higher quote with faster turnaround or more rigorous QA may serve your research better.
Place your first order with a single sequence rather than committing to a bulk order. This lets you evaluate the vendor’s quality, turnaround, and customer service before scaling up.
Understanding peptide synthesis cost per amino acid means looking beyond the headline per-residue rate. FROPeptides provides transparent, batch-verified peptides with multi-stage HPLC testing and mass spectrometry verification for every order. Shop Now to request a quote for your research sequences.
Frequently Asked Questions
How is peptide synthesis cost per amino acid calculated?
Vendors multiply the per-residue rate by the total number of amino acids in your sequence. The base rate varies by vendor and purity level. Crude peptides are less expensive than high-purity (>98%) peptides. Additional fees apply for custom modifications like acetylation or amidation.
Does peptide purity affect the cost of synthesis?
Yes, purity is one of the largest cost drivers. Crude peptides are the least expensive option. Standard purity (typically 70-80%) costs more. High-purity peptides (>98%) can cost significantly more per residue than crude material. Ultra-pure options with mass spectrometry verification command premium pricing. Your choice depends on your analytical requirements and budget.
What should a custom peptide synthesis quote include?
A complete quote lists the per-amino-acid base rate, total residue count, purity level selected, synthesis scale (in milligrams), any modifications (acetylation, amidation, phosphorylation), minimum order charges, delivery timeline, and Certificate of Analysis (CoA) details. It should also specify whether HPLC and mass spectrometry data are included. Ask vendors for batch-level traceability and temperature-controlled shipping terms before committing.
Why do modified peptides cost more than standard peptides?
Modifications like acetylation, amidation, or phosphorylation require extra synthesis steps and reagents, increasing labor and material costs. Each modification typically incurs a separate fee on top of the per-residue rate. Complex modifications or multiple changes per peptide compound the expense. Request an itemized quote if your sequence includes non-standard amino acids or terminal modifications.
